Name :
CD247 (Human) Recombinant Protein
Biological Activity :
Human CD247 (P20963, 52 a.a. – 164 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
P20963
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=919
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Molecular Weight :
15.4
Storage and Stability :
Store at 2°C to 8°C for 2-4 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.15 M NaCl and 10% glycerol)
Applications :
SDS-PAGE,
Gene Name :
CD247
Gene Alias :
CD3-ZETA, CD3H, CD3Q, CD3Z, T3Z, TCRZ
Gene Description :
CD247 molecule
Gene Summary :
The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations :
CD247 antigen, zeta subunit|CD3Z antigen, zeta polypeptide (TiT3 complex)|OTTHUMP00000032544|T-cell antigen receptor complex, zeta subunit of CD3|T-cell receptor T3 zeta chain|T-cell receptor zeta chain|T-cell surface glycoprotein CD3 zeta chain
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Neuropilin-1 ProteinFormulation
ANG-2 Recombinant Proteins
Popular categories:
Serpin A5
PDGF-B
