ACSF2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to thetase family member 2 Antibody against the C terminal of ACSF2. Immunizing peptide sequence DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ACSF2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ACSF2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ACSF2 Antibody
- ACSMW
- acyl-CoA synthetase family member 2
- AVYV493
- EC 6.2.1
- EC 6.2.1.-
- EC 6.2.1.26
- mitochondrial
- PPARG binding, long chain fatty acid acyl Co-A ligase like
Background
Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. ACSF2 has some preference toward medium-chain substrates. It plays a role in adipodyte differentiation.
