Cav3.2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1H.
Source: E.coli Amino Acid Sequence: EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP |
| Protein/Peptide Type |
Recombinant Protein Antigen
|
| Gene |
CACNA1H
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP1-88176.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related protocol, click here.
|
| Theoretical MW |
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 1M Urea, pH 7.4.
|
| Preservative |
No Preservative
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Alternate Names for Cav3.2 Recombinant Protein Antigen
- CACNA1HB
- calcium channel, voltage-dependent, T type, alpha 1H subunit
- calcium channel, voltage-dependent, T type, alpha 1Hb subunit
- Cav3.2
- ECA6
- EIG6
- FLJ90484
- Low-voltage-activated calcium channel alpha1 3.2 subunit
- low-voltage-activated calcium channel alpha13.2 subunit
- voltage dependent t-type calcium channel alpha-1H subunit
- voltage-dependent T-type calcium channel subunit alpha-1H
- voltage-gated calcium channel alpha subunit Cav3.2
- voltage-gated calcium channel alpha subunit CavT.2
- Voltage-gated calcium channel subunit alpha Cav3.2
