EMG1 Antibody Summary
Immunogen |
This antibody was developed against a Recombinant Protein corresponding to amino acids:SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
EMG1
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS, pH 7.2, containing 40% glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for EMG1 Antibody
- 18S rRNA (pseudouridine-N1-)-methyltransferase NEP1
- BWCNS
- C2F18S rRNA Psi1248 methyltransferase
- EMG1 nucleolar protein homolog (S. cerevisiae)
- essential for mitotic growth 1
- FLJ60792
- Grcc2f
- NEP1EC 2.1.1.-
- Nucleolar protein EMG1 homolog
- probable ribosome biogenesis protein NEP1
- Protein C2f
- Ribosome biogenesis protein NEP1