Product: (R)-Rivastigmine (D8 tartrate)
GAPDH Antibody (2597) Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
|
| Isotype |
IgG2a
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
GAPDH
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Protein A purified
|
Alternate Names for GAPDH Antibody (2597)
- aging-associated gene 9 protein
- EC 1.2.1
- EC 1.2.1.12
- EC 2.6.99.-
- G3PD
- G3PDH
- GAPDH
- GAPDPeptidyl-cysteine S-nitrosylase GAPDH
- glyceraldehyde 3-phosphate dehydrogenase
- glyceraldehyde-3-phosphate dehydrogenase
- MGC88685
