GNA11 Antibody Summary
| Immunogen |
The immunogen for this antibody is GNA11 – N-terminal region. Peptide sequence IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
GNA11
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for GNA11 Antibody
- G alpha-11
- GA11
- GNA-11
- G-protein subunit alpha-11
- guanine nucleotide binding protein (G protein), alpha 11 (Gq class)
- Guanine nucleotide-binding protein G(y) subunit alpha
- guanine nucleotide-binding protein subunit alpha-11
- guanine nucleotide-binding protein, Gq class, GNA11
Background
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C.
