GOLGA6 Antibody Summary
Immunogen |
This antibody was developed against a Recombinant Protein corresponding to amino acids:GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
GOLGA6A
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS, pH 7.2, containing 40% glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for GOLGA6 Antibody
- FLJ75859
- GLPGolgin-like protein
- GOLGA6Golgin linked to PML
- golgi autoantigen, golgin subfamily a, 6
- golgi autoantigen, golgin subfamily a, 6A
- golgi autoantigen, golgin subfamily a, member 6
- golgin A6 family, member A
- Golgin subfamily A member 6A