IP3R1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITPR1.
Source: E.coli Amino Acid Sequence: FFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRC |
| Protein/Peptide Type |
Recombinant Protein Antigen
|
| Gene |
ITPR1
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP1-83104.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related protocol, click here.
|
| Theoretical MW |
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 1M Urea, pH 7.4.
|
| Preservative |
No Preservative
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Alternate Names for IP3R1 Recombinant Protein Antigen
- DKFZp313E1334
- DKFZp313N1434
- inositol 14,5-triphosphate receptor, type 1
- inositol 14,5-trisphosphate receptor type 1
- INSP3R1
- IP3 receptor isoform 1
- IP3 receptor
- IP3R 1
- IP3R
- IP3R1
- SCA15
- SCA16
- spinocerebellar ataxia 15
- spinocerebellar ataxia 16
- Type 1 inositol 14,5-trisphosphate receptor
- Type 1 InsP3 receptor
