Mind Bomb 2/MIB2 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MIB2
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for Mind Bomb 2/MIB2 Antibody
- E3 ubiquitin-protein ligase MIB2
- EC 6.3.2
- EC 6.3.2.-
- EC 6.3.2.13
- FLJ20648
- FLJ41406
- MIB2
- Mind Bomb 2
- Mind bomb homolog 2
- Mind Bomb-2
- mindbomb homolog 2 (Drosophila)
- Novel zinc finger protein
- Novelzin
- Putative NF-kappa-B-activating protein 002N
- SKD
- Skeletrophin
- Zinc finger ZZ type with ankyrin repeat domain protein 1
- ZZ type with ankyrin repeat domain 1
- ZZANK1
- ZZZ5
