Share this post on:

Product: D-Glutamine

NUP98 Antibody Summary

Immunogen
Recombinant protein encompassing a sequence within the C-terminus region of human NUP98. The exact sequence is proprietary.
Localization
Nucleus; nuclear pore complex; Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side
Marker
Nuclear Pore Complex Marker
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUP98
Purity
Immunogen affinity purified
Innovators Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Learn about the Innovators Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:3000
  • Immunoprecipitation 1:100-1:500
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
198 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
0.1M Tris (pH 7.0), 0.1M Glycine and 20% Glycerol
Preservative
0.01% Thimerosal
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Alternate Names for NUP98 Antibody

  • ADAR2
  • ADIR2
  • GLFG-repeat containing nucleoporin
  • nuclear pore complex protein Nup98-Nup96
  • nucleoporin 98kD
  • nucleoporin 98kDa
  • NUP196
  • NUP96
  • Nup98-Nup96

Background

Signal-mediated nuclear import and export proceed through the nuclear pore complex (NPC), which is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kD nucleoporin is generated through a biogenesis pathway that involves synthesis and proteolytic cleavage of a 186 kD precursor protein. This cleavage results in the 98 kD nucleoporin as well as a 96 kD nucleoporin, both of which are localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kD nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL). This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. [provided by RefSeq]

PMID: 10188965

Share this post on:

Author: premierroofingandsidinginc

Share this post on:

Product: Torcetrapib

NUP98 Antibody Summary

Immunogen
Synthetic peptides corresponding to NUP98(nucleoporin 98kDa) The peptide sequence was selected from the N terminal of NUP98.Peptide sequence EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF.
Marker
Nuclear Pore Complex Marker
Clonality
Polyclonal
Host
Rabbit
Gene
NUP98
Purity
Immunogen affinity purified
Innovators Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Learn about the Innovators Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NUP98 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NUP98 Antibody

  • ADAR2
  • ADIR2
  • GLFG-repeat containing nucleoporin
  • nuclear pore complex protein Nup98-Nup96
  • nucleoporin 98kD
  • nucleoporin 98kDa
  • NUP196
  • NUP96
  • Nup98-Nup96

Background

The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kD nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kD nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL). This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Signal-mediated nuclear import and export proceed through the nuclear pore complex (NPC), which is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kD nucleoporin is generated through a biogenesis pathway that involves synthesis and proteolytic cleavage of a 186 kD precursor protein. This cleavage results in the 98 kD nucleoporin as well as a 96 kD nucleoporin, both of which are localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kD nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL). This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.

PMID: 19906881

Share this post on:

Author: premierroofingandsidinginc