PSMC1 Antibody Summary
| Immunogen |
Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PSMC1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against Psmc1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PSMC1 Antibody
- 26S protease regulatory subunit 4
- 26S proteasome AAA-ATPase subunit RPT2
- MGC24583
- P26S4
- p56
- proteasome (prosome, macropain) 26S subunit, ATPase, 1
- proteasome 26S ATPase subunit 1
- Proteasome 26S subunit ATPase 1
- proteasome 26S subunit, ATPase, 1
- S4MGC8541
