PTBP1 Antibody Summary
Immunogen |
Synthetic peptides corresponding to PTBP1(polypyrimidine tract binding protein 1) The peptide sequence was selected from the N terminal of PTBP1.Peptide sequence RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI.
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
PTBP1
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
This is a rabbit polyclonal antibody against PTBP1 and was validated on Western blot.
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
Buffer |
PBS & 2% Sucrose.
|
Preservative |
No Preservative
|
Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PTBP1 Antibody
- Heterogeneous nuclear ribonucleoprotein I
- heterogeneous nuclear ribonucleoprotein polypeptide I
- hnRNP I
- HNRNPI
- HNRNP-I
- HNRPI
- MGC10830
- MGC8461
- polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoproteinI)
- polypyrimidine tract binding protein 1
- polypyrimidine tract-binding protein 1
- pPTB
- PTB-1
- PTB2
- PTB3
- PTB4
- PTB57 kDa RNA-binding protein PPTB-1
- PTB-T
- RNA-binding protein
Background
PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described.