Product: (+)-Cevimeline (hydrochloride hemihydrate)
Profilin 1 Antibody (5216) Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KSIGGAPTFNVTVTKTDKTLVLLMGKEGIHG
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG2a
|
Clonality |
Monoclonal
|
Host |
Mouse
|
Gene |
PFN1
|
Purity |
Protein A purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS, pH 7.2, containing 40% glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Protein A purified
|
Alternate Names for Profilin 1 Antibody (5216)
- PFN1
- PROF1
- Profilin 1
- Profilin I
- profilin-1