RAB39 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RAB39 (RAB39, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB39. Peptide sequence METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RAB39A
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RAB39 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RAB39 Antibody
- rab-39
- RAB39, member RAS oncogene family
- RAB39A
- rab-related GTP-binding protein
- ras-related protein Rab-39A
Background
RAB39 may be involved in vesicular trafficking.
