Recombinant Human Desert Hedgehog/Dhh Protein Summary
| Description |
A recombinant protein corresponding to amino acids 23 – 198 of DHH.
Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG |
| Preparation Method |
E.coli
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
DHH
|
| Purity |
>95% pure by SDS-PAGE
|
Applications/Dilutions
| Theoretical MW |
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
20mM MES pH 5.5, 0.5mM DTT, 20% glycerol
|
| Preservative |
No Preservative
|
| Concentration |
1.0 mg/ml
|
| Purity |
>95% pure by SDS-PAGE
|
Notes
The purity of this protein is > 95% by SDS-PAGE. Molecular weight is 22kDa (197aa), confirmed by MALDI-TOF.
Alternate Names for Recombinant Human Desert Hedgehog/Dhh Protein
- desert hedgehog (Drosophila) homolog
- desert hedgehog homolog
- desert hedgehog protein
- Desert Hedgehog
- DHH
- HHG-3MGC35145
Background
Desert Hedgehog belongs to the hedgehog family. The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. The N- terminal domain is the active species in both local and long-range signaling, whereas the C-terminal domain has no signaling activity. This protein is produced by Sertoli cells and may be involved in both male gonadal differentiation and perineurial development. Defects in this protein have been associated with partial gonadal dysgenesis (PGD) accompanied by minifascicular polyneuropathy. Recombinant DHH protein was expressed in E.coli and purified by using conventional chromatography techniques.
