Recombinant Human Growth Hormone 2 Protein Summary
| Description |
A recombinant protein corresponding to GH2.
Amino Acid Sequence: MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
| Preparation Method |
E.coli
|
| Details of Functionality |
Measured in a cell proliferation assay using Nb2-11 Rat lymphoma cells. The ED50 for this effect is less or equal to 1ng/ml.
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
GH2
|
| Purity |
>95% pure by SDS-PAGE
|
| Endotoxin Note |
< 1.0 EU per 1 microgram of protein (determined by LAL method)
|
Applications/Dilutions
| Theoretical MW |
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
Phosphate Buffer Saline (pH 7.4) containing 10% glycerol
|
| Preservative |
No Preservative
|
| Concentration |
1.0 mg/ml
|
| Purity |
>95% pure by SDS-PAGE
|
Notes
The purity of this protein is > 95% by SDS-PAGE. Molecular weight is 20 kDa (177 aa), confirmed by MALDI-TOF.
Alternate Names for Recombinant Human Growth Hormone 2 Protein
- GH2
- GHL
- GHV
- GHVgrowth hormone variant
- GH-VPlacenta-specific growth hormone
- Growth Hormone 2
- growth hormone 2hGH-V
- placental-specific growth hormone
Background
The 20KDa variant form of human growth hormone (20KDa hGH) presents in extracts from pituitary glands and it differs from the major form of hGH (22K, 191 amino acid) by the deletion of amino acid residues 32-46. The physiological role of 20K hGH remains to be determined partly but it regards the main function as stimulation of somatic and bone growth, as well as an increase in the size and mass of organs and tissues. Recombinant 20KDa human growth hormone was purified by FPLC gel-filtration chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
