Solute carrier family 22 member 18 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18.Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC22A18
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SLC22A18 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Solute carrier family 22 member 18 Antibody
- BWR1AORCTL2
- BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like
- Efflux transporter-like protein
- HET
- imprinted multi-membrane spanning polyspecific transporter-related protein 1
- Imprinted multi-membrane-spanning polyspecific transporter-related protein 1
- IMPT1DKFZp667A184
- ITMp45-BWR1A
- ORCTL-2
- organic cation transporter-like 2
- Organic cation transporter-like protein 2
- p45 Beckwith-Wiedemann region 1A
- SLC22A1Lcandidate A
- solute carrier family 22 member 18
- Solute carrier family 22 member 1-like
- solute carrier family 22, member 18
- TSSC5p45-Beckwith-Wiedemann region 1 A
- Tumor-suppressing STF cDNA 5 protein
- Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Background
This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney. Two alternative transcripts encoding the same isoform have been described.
