TMEM110 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to TMEM110(transmembrane protein 110) The peptide sequence was selected form the N terminal of TMEM110. Peptide sequence MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TMEM110
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against TMEM110 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TMEM110 Antibody
- DKFZp667E1121
- DKFZp779M0254
- FLJ37613
- FLJ42395
- MGC52022
- transmembrane protein 110
Background
The function of this protein remains unknown.
