TPPP/p25 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the C terminal of mouse 2900041A09RIK. Peptide sequence KAVSSPTVSRLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGY.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TPPP
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against 2900041A09RIK and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TPPP/p25 Antibody
- p24
- P24,25 kDa brain-specific protein
- p25
- p25alpha
- p25-alpha
- TPPP/p25brain specific protein p25 alpha
- TPPP1glycogen synthase kinase 3 (GSK3) inhibitor p24
- tubulin polymerization promoting protein
- tubulin polymerization-promoting protein
