Product: 9-Aminocephalosporanic acid
TRAPPC1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to TRAPPC1 (trafficking protein particle complex 1) The peptide sequence was selected from the middle region of TRAPPC1)(50ug).Peptide sequence YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM.
|
| Specificity |
This product is specific to Subunit or Isofrom: 1.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TRAPPC1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against TRAPPC1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TRAPPC1 Antibody
- BET5BET5 homolog
- Multiple myeloma protein 2
- MUM-2
- MUM2melanoma ubiquitous mutated 2
- trafficking protein particle complex 1
- trafficking protein particle complex subunit 1
Background
This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.
