Product: (-)-Sparteine (sulfate pentahydrate)
TRM11 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to TRMT11(tRNA methyltransferase 11 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of TRMT11.Peptide sequence IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TRMT11
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against TRMT11 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TRM11 Antibody
- C6orf75
- chromosome 6 open reading frame 75
- dJ187J11.2
- EC 2.1.1
- EC 2.1.1.-
- EC 2.1.1.113
- MDS024
- TRM11
- TRMT11-1
- tRNA guanosine-2-O-methyltransferase TRM11 homolog
- tRNA methyltransferase 11 homolog (S. cerevisiae)
Background
TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.
