Product: Ingenol-5,20-acetonide-5-O-angelate
gp130/CD130 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL6ST.
Source: E.coli Amino Acid Sequence: CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI |
| Protein/Peptide Type |
Recombinant Protein Antigen
|
| Gene |
IL6ST
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP1-88138. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
|
| Theoretical MW |
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 1M Urea, pH 7.4.
|
| Preservative |
No Preservative
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Alternate Names for gp130/CD130 Recombinant Protein Antigen
- CD130 antigen
- CD130
- CDw130
- DKFZp564F053
- gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form
- gp130
- IL-6 receptor subunit beta
- IL-6R subunit beta
- IL-6RB
- IL-6R-beta
- IL6ST
- interleukin 6 signal transducer (gp130, oncostatin M receptor)
- interleukin receptor beta chain
- interleukin-6 receptor subunit beta
- Interleukin-6 signal transducer
- Membrane glycoprotein 130
- membrane glycoprotein gp130
- Oncostatin-M receptor subunit alpha
