p130 Antibody (130P215) Summary
| Immunogen |
Synthetic peptide: QCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQNIM, corresponding to amino acids 878-913 of Human p130.
|
| Localization |
Nuclear
|
| Specificity |
Rb2 p130 (130P215)
|
| Isotype |
IgG1
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
RBL2
|
| Purity |
Unpurified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
IHC-P: 1/25 – 1/50. An incubation period of 30 minutes at room temperature is recommended. Formalin fixed paraffin embedded tissue sections require high temperature antigen unmasking with 10 mM citrate buffer, pH 6.0 prior to immunostaining.
|
Reactivity Notes
Cross-reacts with Human and Rat. Expected to cross-react with Mouse (94% identity with immunogen) due to sequence homology. Not yet tested in other species.
Packaging, Storage & Formulations
| Storage |
Store at 4C. Do not freeze.
|
| Buffer |
Ascites
|
| Preservative |
Sodium Azide
|
| Purity |
Unpurified
|
Alternate Names for p130 Antibody (130P215)
- FLJ26459
- P130
- PRB2
- Rb2
- RBR-2
- retinoblastoma-like 2 (p130)
- retinoblastoma-like protein 2,130 kDa retinoblastoma-associated protein
- Retinoblastoma-related protein 2
Background
Two retinoblastoma related proteins, p107 and pRb2 / p130, which are structurally and functionally similar to the product of the retinoblastoma gene (pRb / p105), were cloned by taking advantage of their ability to bind transforming proteins of DNA tumor viruses through a particular region called the “pocket domain.” Like pRb, both proteins play a fundamental role in growth control. These Rb family proteins were measured in a variety of lung neoplasms. The highest percentage of undetectable levels and the tightest inverse correlation with the histological grading and with PCNA expression in the most aggressive tumor types were found for pRb2 / p130, which may suggest an important role for this protein in the pathogenesis and progression of lung cancer.
