Neurexophilin-3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to NXPH3 (neurexophilin 3) The peptide sequence was selected from the N terminal of NXPH3. Peptide sequence RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NXPH3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against NXPH3 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Neurexophilin-3 Antibody
- KIAA1159
- neurexophilin 3
- Neurexophilin3
- Neurexophilin-3
- NPH3
- NPH3neurexophilin-3
- NXPH3
Background
NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.
