Product: Lactitol (monohydrate)
TPPP3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to TPPP3 (tubulin polymerization-promoting protein family member 3) The peptide sequence was selected from the N terminal of TPPP3.Peptide sequence MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TPPP3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against TPPP3 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TPPP3 Antibody
- brain specific protein
- CGI-38
- p20
- p25gamma
- TPPP/p20
- tubulin polymerization-promoting protein family member 3
Background
TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.
