EVA1/MPZL2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to MPZL2(myelin protein zero-like 2) The peptide sequence was selected from the N terminal of MPZL2.Peptide sequence LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MPZL2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against MPZL2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for EVA1/MPZL2 Antibody
- EVA1
- EVAEpithelial V-like antigen 1EVA1myelin protein zero-like protein 2
- MPZL2
- myelin protein zero-like 2
Background
Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous
