SLMO2 Antibody Summary
Immunogen |
Synthetic peptides corresponding to SLMO2(slowmo homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of SLMO2.Peptide sequence GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV.
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
SLMO2
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
This is a rabbit polyclonal antibody against SLMO2 and was validated on Western blot.
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
Buffer |
PBS and 2% Sucrose
|
Preservative |
0.09% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLMO2 Antibody
- C20orf45
- chromosome 20 open reading frame 45
- dJ543J19.5
- PRELID3B
- protein slowmo homolog 2
- slowmo homolog 2 (Drosophila)
Background
The function of this protein remains unknown.