Product: Bremelanotide (Acetate)
RhoJ Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RHOJ (ras homolog gene family, member J) The peptide sequence was selected from the middle region of RHOJ.Peptide sequence LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RHOJ
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RHOJ and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Concentration |
LYOPH
|
| Purity |
Immunogen affinity purified
|
| Reconstitution Instructions |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RhoJ Antibody
- ARHJTC10B
- FLJ14445
- ras homolog gene family, member J
- RASL7B
- Ras-like protein family member 7B
- RAS-like, family 7, member B
- RHOI
- rho-related GTP-binding protein RhoJ
- Tc10-like GTP-binding protein
- TC10-like Rho GTPase
- TCLMGC34777
Background
ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.
