PAFAH1B2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PAFAH1B2(platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa) The peptide sequence was selected from the N terminal of PAFAH1B2.Peptide sequence MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLD
|
| Specificity |
This product is specific to Subunit or Isofrom: beta.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PAFAH1B2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against PAFAH1B2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PAFAH1B2 Antibody
- EC 3.1.1.47
- intracellular platelet-activating factor acetylhydrolase alpha 2 subunit
- PAF acetylhydrolase 30 kDa subunit
- PAF-AH 30 kDa subunit
- PAFAH subunit beta
- PAF-AH subunit beta
- PAF-AH1b alpha 2 subunit
- PAFAHB
- platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa)
- platelet-activating factor acetylhydrolase IB subunit beta
- platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa
- platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa)
Background
Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript varia
