USH1C Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USH1C.
Source: E.coli Amino Acid Sequence: IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
| Protein/Peptide Type |
Recombinant Protein Antigen
|
| Gene |
USH1C
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP1-89189. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
|
| Theoretical MW |
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 1M Urea, pH 7.4.
|
| Preservative |
No Preservative
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Alternate Names for USH1C Recombinant Protein Antigen
- AIE75
- AIE-75
- Antigen NY-CO-38/NY-CO-37
- Autoimmune enteropathy-related antigen AIE-75
- deafness, autosomal recessive 18
- DFNB18
- harmonin
- NY-CO-37
- NY-CO-38
- PDZ-45
- PDZ73
- PDZ-73
- PDZ-73/NY-CO-38
- Protein PDZ-73
- Renal carcinoma antigen NY-REN-3
- ush1cpst
- Usher syndrome 1C (autosomal recessive, severe)
- Usher syndrome type-1C protein
