Product: Methacholine (chloride)
G gamma14 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
GNGT2
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Mouse 82%, Rat 82%
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for G gamma14 Antibody
- G protein cone gamma 8 subunit
- gamma-T2 subunit
- G-GAMMA-8
- G-gamma-9
- G-GAMMA-C
- GNG8
- GNG9G gamma-C
- GNGT8
- guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2
- guanine nucleotide binding protein gamma 9
- Guanine nucleotide binding protein gamma transducing activity polypeptide 2
- guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
