Carbonic Anhydrase IX/CA9 Antibody Summary
Immunogen |
This antibody was developed against a Recombinant Protein corresponding to amino acids:PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
CA9
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS, pH 7.2, containing 40% glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for Carbonic Anhydrase IX/CA9 Antibody
- CA9
- CA-IX
- CAIXcarbonic anhydrase 9
- Carbonate dehydratase IX
- Carbonic Anhydrase IX
- carbonic anhydrase IXpMW1
- carbonic dehydratase
- EC 4.2.1.1
- G250
- Membrane antigen MN
- MN
- MNRCC-associated antigen G250
- P54/58N
- RCC
- RCC-associated protein G250
- Renal cell carcinoma-associated antigen G250