CD3 gamma Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD3G.
Source: E.coli Amino Acid Sequence: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN |
| Protein/Peptide Type |
Recombinant Protein Antigen
|
| Gene |
CD3G
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP2-32636. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
|
| Theoretical MW |
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 1M Urea, pH 7.4.
|
| Preservative |
No Preservative
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Alternate Names for CD3 gamma Recombinant Protein Antigen
- CD3 gamma
- CD3g antigen
- CD3g antigen, gamma polypeptide (TiT3 complex)
- CD3g molecule, epsilon (CD3-TCR complex)
- CD3g molecule, gamma (CD3-TCR complex)
- CD3g
- CD3-GAMMA
- FLJ17620
- FLJ17664
- FLJ79544
- FLJ94613
- IMD17
- MGC138597
- T3G
- T-cell antigen receptor complex, gamma subunit of T3
- T-cell receptor T3 gamma chain
- T-cell surface glycoprotein CD3 gamma chain
