Blood Group Lewis b Antibody Summary
| Immunogen |
This antibody was developed against a Recombinant Protein corresponding to amino acids:KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
FUT3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for Blood Group Lewis b Antibody
- alpha-(1,3/1,4)-fucosyltransferase
- Blood group Lewis alpha-4-fucosyltransferase
- CD174
- EC 2.4.1
- EC 2.4.1.65
- FT3B
- fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group)
- Fucosyltransferase 3
- Fucosyltransferase III
- FucT-III
- galactoside 3(4)-L-fucosyltransferase
- LEfucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood groupincluded)
- Les
- Lewis FT
- MGC131739
