ELA3A Antibody Summary
| Immunogen |
This antibody was developed against a Recombinant Protein corresponding to amino acids:LFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASL
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CELA3A
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for ELA3A Antibody
- chymotrypsin-like elastase family member 3A
- chymotrypsin-like elastase family, member 3A
- EC 3.4.21
- EC 3.4.21.70
- ELA3A
- ELA3elastase 1
- elastase 3A, pancreatic (protease E)
- elastase 3A, pancreatic
- Elastase IIIA
- elastase-3A
- Protease E
