Product: Lurasidone metabolite 14328
USP18 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP18.
Source: E.coli Amino Acid Sequence: AESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI |
| Protein/Peptide Type |
Recombinant Protein Antigen
|
| Gene |
USP18
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP1-92566. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
|
| Theoretical MW |
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 1M Urea, pH 7.4.
|
| Preservative |
No Preservative
|
| Purity |
>80% by SDS-PAGE and Coomassie blue staining
|
Alternate Names for USP18 Recombinant Protein Antigen
- EC 3.1.2.15
- EC 3.4.19.-
- hUBP43
- ISG15-specific-processing protease
- ISG43
- ISG43UBP43
- ubiquitin specific peptidase 18
- ubiquitin specific protease 18
- ubl carboxyl-terminal hydrolase 18
- ubl thioesterase 18,43 kDa ISG15-specific protease
- Ubl thiolesterase 18
- UBP43
- USP18
