Product: Enalapril (D7 maleate)
ARL17A Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acid sequence:IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ARL17A
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Protein A purified
|
Alternate Names for ARL17A Antibody
- ADP Ribosylation Factor Like GTPase 17A
- ADP-Ribosylation Factor 1 Pseudogene 2
- ADP-Ribosylation Factor 7 Variant
- ADP-Ribosylation Factor 7
- ADP-Ribosylation Factor Like GTPase 17A
- ADP-Ribosylation Factor-Like 17 Pseudogene 1
- ADP-Ribosylation Factor-Like 17-Like
- ADP-ribosylation factor-like protein 17
- ARF1P2
- ARL17A ARL17B
- ARL17P1
