PPP2R2A Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEGAGGGNDIQWCFSQVKGAVDDDVAEADI
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PPP2R2A
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for PPP2R2A Antibody
- B55A
- B55ALPHA
- DKFZp686N05117
- FLJ26613
- FLJ41727
- MGC52248
- PP2A subunit B isoform alpha
- PP2A subunit B isoform B55-alpha
- PP2A subunit B isoform PR55-alpha
- PP2A subunit B isoform R2-alpha
- PR52A
- PR55A
- protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), alphaisoform
- protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform
- protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform
- protein phosphatase 2, regulatory subunit B, alpha
- serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alphaisoform
- serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alphaisoform
