Ataxin 1 Antibody (S76-8) Summary
| Immunogen |
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 and it detects a 85 kDa protein
|
| Localization |
Cytoplasm, Nucleus
|
| Specificity |
Detects approx 85kDa.
|
| Isotype |
IgG2b
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
ATXN1
|
| Purity |
Protein G purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
1 ug/ml of Ataxin 1 Antibody was sufficient for detection of Ataxin-1 in 20 ug of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary Antibody.
|
Reactivity Notes
Based on homology, Its predicted to detect Human and Rat.
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4) and 50% Glycerol
|
| Preservative |
0.1% Sodium Azide
|
| Concentration |
1 mg/ml
|
| Purity |
Protein G purified
|
Alternate Names for Ataxin 1 Antibody (S76-8)
- ataxin 1
- ataxin 1)
- ataxin-1
- ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant
- SCA1D6S504E
- Spinocerebellar ataxia type 1 protein
