Recombinant Human Prolactin Protein Summary
| Description |
A recombinant protein corresponding to amino acids 29 – 227 of PRL.
Amino Acid Sequence: MLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
| Preparation Method |
E.coli
|
| Details of Functionality |
Measured in a cell proliferation assay using Nb2-11 Rat lymphoma cells. The ED50 for this effect is less or equal to 0.5 ng/ml.
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
PRL
|
| Purity |
>95% pure by SDS-PAGE
|
Applications/Dilutions
| Theoretical MW |
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
Phosphate buffer saline (pH 7.4)
|
| Preservative |
No Preservative
|
| Concentration |
1.0 mg/ml
|
| Purity |
>95% pure by SDS-PAGE
|
Notes
The purity of this protein is > 95% by SDS-PAGE. Molecular weight is 23 kDa (200 aa), confirmed by MALDI-TOF.
Alternate Names for Recombinant Human Prolactin Protein
- PRL
- Prolactin
Background
Prolactin is a hormone synthesised and secreted by lactotrope cells in the adenohypophysis(anterior pituitary gland). Prolactin has many effects, the most significant of which is to stimulate the mammary glands to produce milk (lactation).Increased serum prolactin during pregnancy causes enlargement of the mammary glands of the breasts and increases the production of milk. Recently, prolactin has demonstrated broader roles in breast cancer development, regulation of reproductive function, and immunoregulation. Prolactin was expressed in E.coli and purifed by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
