Recombinant Human IL-15 Protein Summary
| Description |
A recombinant protein corresponding to amino acids 49 – 162 of IL15.
Amino Acid Sequence: MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH |
| Preparation Method |
E.coli
|
| Details of Functionality |
Measured in a cell proliferation assay using CTLL2 mouse cytotoxic T cells. The ED50 for this effect is < 2.5 ng/ml.
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
IL15
|
| Purity |
>95% pure by SDS-PAGE
|
| Endotoxin Note |
< 1.0 EU per 1 microgram of protein (determined by LAL method)
|
Applications/Dilutions
| Application Notes |
Assay
Cell line: CTLL2 (mouse cytotoxic Tcell) Maintenance Condition: 10% FBS RPMI 1640 with hIL2 Assay Medium: 10% FBS RPMI 1640 without hIL2 Cell Density: 2 x 10,000 cells/well (96 well plate, final volume 100ul) Starvation: 24hr, Assay medium Incubation Time: 48 hr (after sample treatment) Concentration Range: 0.039 ng/ml – 40 ng/ml Detection Method: MTT assay |
| Theoretical MW |
13.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
|
| Preservative |
No Preservative
|
| Concentration |
1.0 mg/ml
|
| Purity |
>95% pure by SDS-PAGE
|
Notes
The purity of this protein is > 95% by SDS-PAGE. Molecular weight is 13.9kDa (123aa), confirmed by MALDI-TOF.
Alternate Names for Recombinant Human IL-15 Protein
- IL15
- IL-15
- IL-15MGC9721
- interleukin 15
- interleukin-15
Background
Interleukin (IL)-15 is a pleiotropic cytokine that plays a pivotal role in both innate and adaptive immunity. IL-15 is unique among cytokines due to its participation in a trans signaling mechanism in which IL-15 receptor alpha (IL-15R alpha) from one subset of cells presents IL-15 to neighboring IL-2R beta/gamma(c)-expressing cells. This newly discovered cytokine is produced by a wide variety of cells and tissues and like IL-2, stimulates the proliferation of T-lymphocytes and induces the generation of cytotoxic T-lymphocytes (CTLs) and lymphokine-activated killer (LAK) cells. Recombinant human IL-15 was expressed in E.coli and purified by using conventional chromatography after refolding of the isolated inclusion bodies in a redox buffer.
